Novus Biologicals
Manufacturer Code:NBP192204
Catalog # NBP192204
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:TSDEHLSVVRYLATAHIDGAVIITTPQEVSLQDVRKEINFCRKVKLPIIGVVEN |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: Cytosolic Fe-S cluster assembly factor NUBP1; cytosolic Fe-S cluster assembly factor NUBP1 MGC117406 MGC130053 NBP 1 NBP1 NBPMGC130052 nucleotide binding protein (e.coli MinD like) nucleotide binding protein 1 (E.coli MinD like) nucleotide binding protein 1 (MinD homolog E. coli) Nucleotide-binding protein 1; NBP 1; NUBP1; nucleotide binding protein (e.coli MinD like); nucleotide binding protein 1 (E.coli MinD like); nucleotide binding protein 1 (MinD homolog, E. coli); Nucleotide-binding protein 1
Gene Aliases: NBP; NBP1; NBP35; NUBP1
UniProt ID: (Human) P53384
Entrez Gene ID: (Human) 4682
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.