Novus Biologicals
Manufacturer Code:NBP15691120UL
Catalog # NBP156920UL
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to NT5C1B(5'-nucleotidase cytosolic IB) The peptide sequence was selected from the N terminal of NT5C1B. Peptide sequence MSQTSLKQKKNEPGMRSSKESLEAEKRKESDKTGVRLSNQGSQESSLRKT. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: 5'-nucleotidase cytosolic IB AIRPcytosolic 5'-nucleotidase 1B Autoimmune infertility-related protein CN1B cN-IB Cytosolic 5'-nucleotidase IB EC 3.1.3.5 MGC26640; Autoimmune infertility-related protein; cN-IB; cN1B; Cytosolic 5'-nucleotidase 1B; Cytosolic 5'-nucleotidase IB; testicular tissue protein Li 1
Gene Aliases: AIRP; CN-IB; CN1B; FKSG85; NT5C1B
UniProt ID: (Human) Q96P26
Entrez Gene ID: (Human) 93034
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.