Novus Biologicals
Manufacturer Code:NBP184564
Catalog # NBP184564
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:GALDAVREMNDLPDTQVFICTSPLLKYHHCVGEKYRWVEQHLGPQFVERIILTRDKTVVL |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: 3'-pyrimidine nucleotidase 5' nucleotidase deoxy (pyrimidine) cytosolic type C 5' 3'-nucleotidase cytosolic cdN Cytosolic 5' Deoxy-5'-nucleotidase 1 dNT-15'(3')-deoxyribonucleotidase cytosolic type DNT1DNT-1 EC 3.1.3.- P5N2 PN-I PN-II UMPH2DNT uridine 5'-monophosphate phosphohydrolase 2 uridine 5-prime monophosphate hydrolase 2; 5' nucleotidase, deoxy (pyrimidine), cytosolic type C; 5'(3')-deoxyribonucleotidase, cytosolic type; Cytosolic 5',3'-pyrimidine nucleotidase; Deoxy-5'-nucleotidase 1; dNT-1; epididymis luminal protein 74; uridine 5'-monophosphate phosphohydrolase 2; uridine 5-prime monophosphate hydrolase 2
Gene Aliases: cdN; DNT; dNT-1; DNT1; HEL74; NT5C; P5N2; PN-I; PN-II; UMPH2
UniProt ID: (Human) Q8TCD5
Entrez Gene ID: (Human) 30833
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.