Novus Biologicals
Manufacturer Code:NBP258249
Catalog # NBP258249
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunocytochemistry (ICC) | Assay dependent |
Immunofluorescence (IF) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:MPSRQLEDPGAGTPSPVRLHALAGFQQRALCHALTFPSLQRL |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: 28S rRNA (cytosine-C(5))-methyltransferase; EC 2.1.1.- FLJ10267 member 5A MGC986 NOL1 NOL1/NOP2/Sun domain family member 5 NOL1/NOP2/Sun domain family member 5 NOL1R(NOL1) NOL1-related protein NOP2/Sun domain family member 5 NSUN5A p120 putative methyltransferase NSUN5 WBSCR20 WBSCR20A Williams-Beuren syndrome chromosomal region 20A protein Williams-Beuren syndrome critical region protein 20 copy A Ynl022cL; NOL1-related protein; NOL1/NOP2/Sun domain family member 5; NOL1R; NOP2/Sun domain family, member 5; NOP2/Sun domain family, member 5A; putative methyltransferase NSUN5; Williams Beuren syndrome chromosome region 20A; Williams-Beuren syndrome chromosomal region 20A protein; Williams-Beuren syndrome critical region protein 20 copy A
Gene Aliases: NOL1; NOL1R; NSUN5; NSUN5A; p120; p120(NOL1); WBSCR20; WBSCR20A
UniProt ID: (Human) Q96P11
Entrez Gene ID: (Human) 55695
Molecular Function:
methyltransferase
nucleic acid binding
transferase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.