Novus Biologicals
Manufacturer Code:NBP155169
Catalog # NBP155169
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to NSUN3(NOL1/NOP2/Sun domain family member 3) The peptide sequence was selected from the middle region of NSUN3. Peptide sequence GGKSIALLQCACPGYLHCNEYDSLRLRWLRQTLESFIPQPLINVIKVSEL. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: EC 2.1.1 EC 2.1.1.- FLJ22109 FLJ22609 MST077 NOL1/NOP2/Sun domain family 3 NOL1/NOP2/Sun domain family member 3 NOL1/NOP2/Sun domain family member 3 NOP2/Sun domain family member 3 putative methyltransferase NSUN3; NOL1/NOP2/Sun domain family 3; NOL1/NOP2/Sun domain family member 3; NOL1/NOP2/Sun domain family, member 3; NOP2/Sun domain family, member 3; tRNA (cytosine(34)-C(5))-methyltransferase, mitochondrial
Gene Aliases: MST077; MSTP077; NSUN3; UG0651E06
UniProt ID: (Human) Q9H649
Entrez Gene ID: (Human) 63899
Molecular Function: methyltransferase nucleic acid binding transferase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.