Novus Biologicals
Manufacturer Code:NBP182189
Catalog # NBP182189
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:PFVFIPEDDPLFPPIEKFYALDPSFPRMNLLTRTTEGKKRQLYMVSKELRNVLLNNSEKMKVINTGIKVWCRNNSGEEFDCAFRLAQ |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: 5-methycytoisine methyltransferase; EC 2.1.1 EC 2.1.1.29 FLJ203035-methycytoisine methyltransferase hTrm4 member 2 Myc-induced SUN-domain-containing protein NOL1/NOP2/Sun domain family 2 NOL1/NOP2/Sun domain family member 2 NOP2/Sun domain family member 2 SAKIMisu Substrate of AIM1/Aurora kinase B TRM4MISU tRNA (cytosine-5-)-methyltransferase tRNA (cytosine-5-)-methyltransferase NSUN2 tRNA methyltransferase 4 homolog; hTrm4; Misu; mRNA cytosine C(5)-methyltransferase; Myc-induced SUN domain-containing protein; Myc-induced SUN-domain-containing protein; NOL1/NOP2/Sun domain family member 2; NOL1/NOP2/Sun domain family, member 2; NOP2/Sun domain family, member 2; NOP2/Sun RNA methyltransferase family, member 2; RNA cytosine C(5)-methyltransferase NSUN2; Substrate of AIM1/Aurora kinase B; tRNA (cytosine-5-)-methyltransferase NSUN2; tRNA cytosine C(5)-methyltransferase; tRNA methyltransferase 4 homolog
Gene Aliases: MISU; MRT5; NSUN2; SAKI; TRM4
UniProt ID: (Human) B3KP09
Entrez Gene ID: (Human) 54888
Molecular Function: methyltransferase nucleic acid binding transferase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.