Novus Biologicals
Manufacturer Code:NBP213676
Catalog # NBP213676
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunocytochemistry (ICC) | Assay dependent |
Immunofluorescence (IF) | Assay dependent |
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: MAAERQEALREFVAVTGAEEDRARFFLESAGWDLQIALASFYEDGGDEDI VTISQATPSSVSRGTAPSDNRVTSFRDLIHDQDADEE |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: dJ776F14.1 NSFL1 (p97) cofactor (p47) NSFL1 cofactor p47 p47 p97 cofactor p47 SHP1 homolog UBX domain protein 2C UBX domain-containing protein 2C UBX1 UBXD10 UBXN2CMGC3347; NSFL1 (p97) cofactor (p47); NSFL1 cofactor p47; p97 cofactor p47; SHP1 homolog; UBX domain-containing protein 2C
Gene Aliases: dJ776F14.1; NSFL1C; P47; UBX1; UBXD10; UBXN2C
UniProt ID: (Human) Q9UNZ2
Entrez Gene ID: (Human) 55968
Molecular Function:
membrane traffic protein
membrane trafficking regulatory protein
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.