Novus Biologicals
Manufacturer Code:NBP182399
Catalog # NBP182399
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunocytochemistry (ICC) | Assay dependent |
Immunofluorescence (IF) | Assay dependent |
Immunohistochemistry (Frozen) (IHC (F)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptide towards Rest. Peptide sequence ANMGMALTNDMYDLHELSKAELAAPQLIMLANVALTGEASGSCCDYLVGE. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: Neural-restrictive silencer factor; Neural-restrictive silencer factor NRSFneuron restrictive silencer factor RE1-silencing transcription factor X2 box repressor XBRrepressor binding to the X2 box; neuron restrictive silencer factor; neuron-restrictive silencer factor; RE1-silencing transcription factor; RE1-silencing transcription factor variant E1a/E2/E3/E4c; RE1-silencing transcription factor variant E1a/E2/E3/E5; RE1-silencing transcription factor variant E1a/E2/E3/N3a/E4i; RE1-silencing transcription factor variant E1a/E2/E3/N3c/E4; RE1-silencing transcription factor variant E1a/E2/E4; RE1-silencing transcription factor variant E1a/E2/E5; RE1-silencing transcription factor variant E1a/E2a/E2k; RE1-silencing transcription factor variant E1a/E2d/E4g; RE1-silencing transcription factor variant E1a/E2e/E4h; RE1-silencing transcription factor variant E1a/E2f/E4e; RE1-silencing transcription factor variant E1a/E2k/E2i/E3/E4j; RE1-silencing transcription factor variant E1b/E2/E3/E5; RE1-silencing transcription factor variant E1b/E2/E3/N3b/E4i; RE1-silencing transcription factor variant E1b/E2/E3/N3c/E4; RE1-silencing transcription factor variant E1b/E2a/E2k; RE1-silencing transcription factor variant E1b/E2c/E2j/E3/E4; RE1-silencing transcription factor variant E1b/E2e/E4h; RE1-silencing transcription factor variant E1c/E2/E3/E5; RE1-silencing transcription factor variant E1c/E2a/E2k; RE1-silencing transcription factor variant E1c/E2g/E3/E4; repressor binding to the X2 box; X2 box repressor
Gene Aliases: NRSF; REST; WT6; XBR
UniProt ID: (Human) Q13127
Entrez Gene ID: (Human) 5978
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.