Novus Biologicals
Manufacturer Code:NBP232469
Catalog # NBP232469
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: MEGPLNLAHQQSRRADRLLAAGKYEEAISCHKKAAAYLSEAMKLTQSEQAHLSLELQRDSHMKQLLLIQERWKRAQREERLKAQQNT |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: Comodulator of PPAR and RXR; comodulator of PPAR and RXR 1; comodulator of PPAR and RXR 2; Comodulator of PPAR and RXR COPR COPR1 COPR2 DKFZp564C1664 FLJ30395 NRBF-2 nuclear receptor binding factor 2 nuclear receptor binding factor-2 nuclear receptor-binding factor 2; NRBF-2; nuclear receptor binding factor-2; Nuclear receptor-binding factor 2
Gene Aliases: COPR; COPR1; COPR2; NRBF-2; NRBF2
UniProt ID: (Human) Q96F24
Entrez Gene ID: (Human) 29982
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.