Novus Biologicals
Manufacturer Code:NBP191840
Catalog # NBP191840
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:QCLIALGMSFLDCGHTCHLGLTAQPELYLLNTMDADSLVSR |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: DCT1NRAMP 2 Divalent cation transporter 1 Divalent metal transporter 1 DMT-1 DMT1FLJ37416 member 2 NRAMP2natural resistance-associated macrophage protein 2 solute carrier family 11 (proton-coupled divalent metal ion transporters); Divalent cation transporter 1; Divalent metal transporter 1; DMT-1; Natural resistance-associated macrophage protein 2; NRAMP 2; solute carrier family 11 (proton-coupled divalent metal ion transporter), member 2; solute carrier family 11 (proton-coupled divalent metal ion transporters), member 2; Solute carrier family 11 member 2
Gene Aliases: AHMIO1; DCT1; DMT1; NRAMP2; OK/SW-cl.20; SLC11A2
UniProt ID: (Human) P49281
Entrez Gene ID: (Human) 4891
Molecular Function: cation transporter transporter
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.