Novus Biologicals
Manufacturer Code:NBP155295
Catalog # NBP155295
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to NR4A3(nuclear receptor subfamily 4 group A member 3) The peptide sequence was selected from the middle region of NR4A3 (AAB02581). Peptide sequence KCLSVGMVKEVVRTDSLKGRRGRLPSKPKSPLQQEPSQPSPPSPPICMMN. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: CHN CSMF MINOR NOR1 TEC; chondrosarcoma, extraskeletal myxoid, fused to EWS; Mitogen-induced nuclear orphan receptor; Neuron-derived orphan receptor 1; Nuclear hormone receptor NOR-1; Nuclear receptor subfamily 4 group A member 3; nuclear receptor subfamily 4, group A, member 3; translocated in extraskeletal chondrosarcoma
Gene Aliases: CHN; CSMF; MINOR; NOR1; NR4A3; TEC
UniProt ID: (Human) Q92570
Entrez Gene ID: (Human) 8013
Molecular Function:
nuclear hormone receptor
receptor
transcription factor
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.