Novus Biologicals
Manufacturer Code:NBP192197
Catalog # NBP192197
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunocytochemistry (ICC) | Assay dependent |
Immunofluorescence (IF) | Assay dependent |
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:EGSLNGLDSALDQVQRRGSLPPRQVPRGEVFRPHRWHLKHLEPVDFLGKAKVVASAIPDDQGWGVRPQQPQGPGANHDARSLIMDSPR |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: Antigen NY-CO-31; Antigen NY-CO-31 FLJ25475 inhibitory NADPH oxidase activator 1 MGC131800 NADPH oxidase activator 1 NCF2-like protein NOX activator 1 NY-CO-31 p51-nox p51NOX P67phox-like factor SDCCAG31 serologically defined colon cancer antigen 31; inhibitory NADPH oxidase activator 1; NADPH oxidase activator 1; NCF2-like protein; NOX activator 1; p51-nox; P67phox-like factor; serologically defined colon cancer antigen 31
Gene Aliases: NOXA1; NY-CO-31; P51NOX; SDCCAG31
UniProt ID: (Human) Q86UR1
Entrez Gene ID: (Human) 10811
Molecular Function:
oxidase
oxidoreductase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.