Novus Biologicals
Manufacturer Code:NBP2841900.1ML
Catalog # NB032118
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | The immunogen is a synthetic peptide directed towards the following sequence KQIAYNHPSSSIGVFFCGPKALSRTLQKMCHLYSSADPRGVHFYYNKESF |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4°C short term. Aliquot and store at -20°:C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: EC 1.6.3 GP91-3EC 1.6.3.- gp91phox homolog 3 Mitogenic oxidase 2 MOX2 MOX-2 NADPH oxidase 3 NADPH oxidase catalytic subunit-like 3; GP91-3; gp91phox homolog 3; Mitogenic oxidase 2; MOX-2; NADPH oxidase 3; NADPH oxidase catalytic subunit-like 3
Gene Aliases: GP91-3; MOX-2; MOX2; NOX3
UniProt ID: (Human) Q9HBY0
Entrez Gene ID: (Human) 50508
Molecular Function:
oxidase
oxidoreductase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.