Novus Biologicals
Manufacturer Code:NBP169573
Catalog # NBP169573
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
ELISA (ELISA) | Assay dependent |
Immunocytochemistry (ICC) | Assay dependent |
Immunofluorescence (IF) | Assay dependent |
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to NOX1(NADPH oxidase 1) The peptide sequence was selected from the C terminal of human NOX1. Peptide sequence STIATSHPKSVVGVFLCGPRTLAKSLRKCCHRYSSLDPRKVQFYFNKENF. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: EC 1.6.3 GP91-2 Mitogenic oxidase 1 MOX-1 MOX1NADH/NADPH mitogenic oxidase subunit P65-MOX NADPH oxidase 1 NADPH oxidase homolog-1 NOH1mitogenic oxidase (pyridine nucleotide-dependent superoxide-generating) NOH-1NADPH oxidase 1 variant NOH-1L NOX-1; mitogenic oxidase (pyridine nucleotide-dependent superoxide-generating); Mitogenic oxidase 1; MOX-1; NADH/NADPH mitogenic oxidase subunit P65-MOX; NADPH oxidase 1; NADPH oxidase homolog-1; NOH-1; NOX-1
Gene Aliases: GP91-2; MOX1; NOH-1; NOH1; NOX1
UniProt ID: (Human) Q9Y5S8
Entrez Gene ID: (Human) 27035
Molecular Function:
oxidase
oxidoreductase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.