Novus Biologicals
Manufacturer Code:NBP198487
Catalog # NBP198487
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | The immunogen for this antibody is NOS1AP - C-terminal region. Peptide sequence PEDTPPPAQGEALLGGLELIKFRESGIASEYESNTDESEERDSWSQEELP. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: 6330408P19Rik CAPONMGC138500 carboxyl-terminal PDZ ligand of neuronal nitric oxide synthase protein C-terminal PDZ ligand of neuronal nitric oxide synthase protein KIAA0464C-terminal PDZ domain ligand of neuronal nitric oxide synthase (CAPON) ligand of neuronal nitric oxide synthase with carboxyl-terminal PDZ domain nitric oxide synthase 1 (neuronal) adaptor protein Nitric oxide synthase 1 adaptor protein; C-terminal PDZ domain ligand of neuronal nitric oxide synthase (CAPON); C-terminal PDZ ligand of neuronal nitric oxide synthase protein; Carboxyl-terminal PDZ ligand of neuronal nitric oxide synthase protein; ligand of neuronal nitric oxide synthase with carboxyl-terminal PDZ domain; nitric oxide synthase 1 (neuronal) adaptor protein; Nitric oxide synthase 1 adaptor protein
Gene Aliases: 6330408P19Rik; CAPON; KIAA0464; NOS1AP
UniProt ID: (Human) O75052
Entrez Gene ID: (Human) 9722
Molecular Function:
signaling molecule
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.