Novus Biologicals
Manufacturer Code:NBP157358
Catalog # NBP157358
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to NOL5A(nucleolar protein 5A (56kDa with KKE/D repeat)) The peptide sequence was selected from the middle region of NOL5A. Peptide sequence YGYHFPELVKIINDNATYCRLAQFIGNRRELNEDKLEKLEELTMDGAKAK. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: NOL5A NOP56 ribonucleoprotein homolog (yeast) nucleolar protein 56 Nucleolar protein 5A nucleolar protein 5A (56kD with KKE/D repeat) nucleolar protein 5A (56kDa with KKE/D repeat); NOP56 ribonucleoprotein homolog; Nucleolar protein 56; Nucleolar protein 5A; nucleolar protein 5A (56kDa with KKE/D repeat)
Gene Aliases: NOL5A; NOP56; SCA36
UniProt ID: (Human) O00567
Entrez Gene ID: (Human) 10528
Molecular Function:
RNA binding protein
nucleic acid binding
ribonucleoprotein
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.