Novus Biologicals
Manufacturer Code:NBP156381
Catalog # NBP156381
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to NOLA3 The peptide sequence was selected from the middle region of NOLA3. Peptide sequence MFLQYYLNEQGDRVYTLKKFDPMGQQTCSAHPARFSPDDKYSRHRITIKK. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: H/ACA ribonucleoprotein complex subunit 3; H/ACA ribonucleoprotein complex subunit 3 homolog of yeast Nop10p MGC70651 NOLA3Nucleolar protein family A member 3 NOP10 ribonucleoprotein homolog (yeast) NOP10P Nucleolar protein 10 nucleolar protein family A member 3 (H/ACA small nucleolar RNPs) snoRNP protein NOP10; homolog of yeast Nop10p; NOP10 ribonucleoprotein homolog; Nucleolar protein 10; Nucleolar protein family A member 3; nucleolar protein family A, member 3 (H/ACA small nucleolar RNPs); snoRNP protein NOP10
Gene Aliases: DKCB1; NOLA3; NOP10; NOP10P
UniProt ID: (Human) Q9NPE3
Entrez Gene ID: (Human) 55505
Molecular Function: RNA binding protein nucleic acid binding ribosomal protein
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.