Novus Biologicals
Manufacturer Code:NBP238625
Catalog # NBP238625
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunocytochemistry (ICC) | Assay dependent |
Immunofluorescence (IF) | Assay dependent |
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: VVVSKSGSLKKRKQNEAAKEAETPQAKKIKLQTPNTFPKRKKGEKRASSPFRRVREEEIEVDSRVADNSFDAKRGAAGDWGERANQVLKF |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: 140 kDa nucleolar phosphoprotein; 140 kDa nucleolar phosphoprotein HCV NS5A trans-regulated protein 13 HCV NS5A-transactivated protein 13 Hepatitis C virus NS5A-transactivated protein 13 KIAA0035NS5ATP13 NOPP130 NOPP140 Nucleolar 130 kDa protein nucleolar and coiled-body phosphoprotein 1 nucleolar and coiled-body phosphprotein 1 Nucleolar phosphoprotein p130 nucleolar protein p130 P130; HCV NS5A trans-regulated protein 13; HCV NS5A-transactivated protein 13; Hepatitis C virus NS5A-transactivated protein 13; Nopp140; Nucleolar 130 kDa protein; Nucleolar and coiled-body phosphoprotein 1; nucleolar and coiled-body phosphprotein 1; Nucleolar phosphoprotein p130; nucleolar protein p130
Gene Aliases: KIAA0035; NOLC1; NOPP130; NOPP140; NS5ATP13; P130
UniProt ID: (Human) Q14978
Entrez Gene ID: (Human) 9221
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.