Novus Biologicals
Manufacturer Code:NBP192192
Catalog # NBP192192
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunocytochemistry (ICC) | Assay dependent |
Immunofluorescence (IF) | Assay dependent |
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Immunoprecipitation (IP) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:KLMDLFPLSELVEFLEANEVPRPVTLRTNTLKTRRRDLAQALINRGVNLDPLGKWSKTGLVVYDSSVPIGATPEYLAGH |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: EC 2.1.1 EC 2.1.1.- MGC149287 MGC149288 NOL1/NOP2/Sun domain family member 1 NOL1MGC117384 NOP120 NOP2 nucleolar protein homolog (yeast) NOP2/Sun domain family member 1 NSUN1 Nucleolar protein 1 nucleolar protein 1 (120kD) nucleolar protein 1 120kDa Nucleolar protein 2 homolog nucleolar protein 2 homolog (yeast) p120 Proliferating-cell nucleolar antigen p120 Proliferation-associated nucleolar protein p120 putative ribosomal RNA methyltransferase NOP2; NOL1/NOP2/Sun domain family, member 1; NOP2 nucleolar protein homolog; Nucleolar protein 1; nucleolar protein 1, 120kDa; Nucleolar protein 2 homolog; Probable 28S rRNA (cytosine(4447)-C(5))-methyltransferase; Proliferating-cell nucleolar antigen p120; Proliferation-associated nucleolar protein p120; putative ribosomal RNA methyltransferase NOP2
Gene Aliases: NOL1; NOP120; NOP2; NSUN1; p120
UniProt ID: (Human) P46087
Entrez Gene ID: (Human) 4839
Molecular Function:
methyltransferase
nucleic acid binding
transferase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.