Novus Biologicals
Manufacturer Code:NBP256871
Catalog # NBP256871
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunocytochemistry (ICC) | Assay dependent |
Immunofluorescence (IF) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:LLGKVQENSAYICSRRQRVSFGVSEQQAVEAWEKLTREEGTPLTLYYSHWRKLRDREIQLEISGKERLEDLNFPEIKRRKMADRKDEDRKQFKDLFDLNSS |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: DKFZP564C186 FLJ35172 NET15 NET7 NIR NOC2-like protein novel INHAT (inhibitor of histone acetyltransferase) repressor nucleolar complex associated 2 homolog (S. cerevisiae) nucleolar complex protein 2 homolog Protein NOC2 homolog; NOC2-like nucleolar associated transcriptional repressor; NOC2-like protein; NOC2L nucleolar associated transcriptional repressor; novel INHAT (inhibitor of histone acetyltransferase) repressor; Novel INHAT repressor; nucleolar complex associated 2 homolog; Nucleolar complex protein 2 homolog; Protein NOC2 homolog; protein phosphatase 1, regulatory subunit 12
Gene Aliases: NET15; NET7; NIR; NOC2L; PPP1R112
UniProt ID: (Human) Q9Y3T9
Entrez Gene ID: (Human) 26155
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.