Novus Biologicals
Manufacturer Code:NBP155404
Catalog # NBP155404
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to NOB1(NIN1/RPN12 binding protein 1 homolog (S. cerevisiae)) The peptide sequence was selected from the N terminal of NOB1. Peptide sequence TEIRDKATRRRLAVLPYELRFKEPLPEYVRLVTEFSKKTGDYPSLSATDI. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: adenocarcinoma antigen recognized by T lymphocytes 4; adenocarcinoma antigen recognized by T lymphocytes 4 ART4 ART-4 MST158 nin one binding protein NIN1/RPN12 binding protein 1 homolog (S. cerevisiae) NOB1PPSMD8BP1 Phosphorylation regulatory protein HP-10 Protein ART-4 PSMD8 binding protein 1 RNA-binding protein NOB1; nin one binding protein; NIN1/RPN12 binding protein 1 homolog; Phosphorylation regulatory protein HP-10; Protein ART-4; PSMD8 binding protein 1; RNA-binding protein NOB1
Gene Aliases: ART-4; ART4; MST158; MSTP158; NOB1; NOB1P; PSMD8BP1
UniProt ID: (Human) Q9ULX3
Entrez Gene ID: (Human) 28987
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.