Novus Biologicals
Manufacturer Code:NBP182548
Catalog # NBP182548
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunocytochemistry (ICC) | Assay dependent |
Immunofluorescence (IF) | Assay dependent |
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:MADESETAVKPPAPPLPQMMEGNGNGHEHCSDCENEEDNSYNRGGLSPANDTGAK |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: alternative short form NMT-S glycylpeptide N-tetradecanoyltransferase 1 long form NMT-L Myristoyl-CoA:protein N-myristoyltransferase 1 NMT 1 NMTEC 2.3.1.97 N-myristoyltransferase 1 Peptide N-myristoyltransferase 1 Type I N-myristoyltransferase; alternative, short form NMT-S; Glycylpeptide N-tetradecanoyltransferase 1; long form, NMT-L; Myristoyl-CoA:protein N-myristoyltransferase 1; NMT 1; Peptide N-myristoyltransferase 1; type I N-myristoyltransferase
Gene Aliases: NMT; NMT1
UniProt ID: (Human) P30419
Entrez Gene ID: (Human) 4836
Molecular Function:
transferase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.