Novus Biologicals
Manufacturer Code:NBP255011
Catalog # NBP255011
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunocytochemistry (ICC) | Assay dependent |
Immunofluorescence (IF) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:MHLRMFEVARDHLHQTGMYQVIQGIISPVNDTYGKKDLAASHHRVAMARLALQTSDWIR |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: EC 2.7.7.1 EC 2.7.7.18 NaMN adenylyltransferase 3 nicotinamide mononucleotide adenylyltransferase 3 nicotinamide nucleotide adenylyltransferase 3 Nicotinate-nucleotide adenylyltransferase 3 PNAT-3 PNAT3NMN adenylyltransferase 3 Pyridine nucleotide adenylyltransferase 3; NaMN adenylyltransferase 3; nicotinamide mononucleotide adenylyltransferase 3; Nicotinamide-nucleotide adenylyltransferase 3; Nicotinamide/nicotinic acid mononucleotide adenylyltransferase 3; Nicotinate-nucleotide adenylyltransferase 3; NMN adenylyltransferase 3; NMN/NaMN adenylyltransferase 3; PNAT-3; Pyridine nucleotide adenylyltransferase 3
Gene Aliases: FKSG76; NMNAT3; PNAT-3; PNAT3
UniProt ID: (Human) Q96T66
Entrez Gene ID: (Human) 349565
Molecular Function:
nucleotidyltransferase
transferase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.