Novus Biologicals
Manufacturer Code:NBP232464
Catalog # NBP232464
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunocytochemistry (ICC) | Assay dependent |
Immunofluorescence (IF) | Assay dependent |
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: LIPAYHRVIMAELATKNSKWVEVDTWESLQKEWKETLKVLRHHQEKLEASDCDHQQNSPTLERPGRKRKWTETQD |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: EC 2.7.7.1 EC 2.7.7.18 NaMN adenylyltransferase 1 nicotinamide mononucleotide adenylyltransferase 1 nicotinamide nucleotide adenylyltransferase nicotinamide nucleotide adenylyltransferase 1 Nicotinate-nucleotide adenylyltransferase 1 NMN adenylyltransferase 1 NMNATPNAT1 pyridine nucleotide adenylyltransferase 1; NaMN adenylyltransferase 1; nicotinamide mononucleotide adenylyltransferase 1; Nicotinamide-nucleotide adenylyltransferase 1; Nicotinamide/nicotinic acid mononucleotide adenylyltransferase 1; Nicotinate-nucleotide adenylyltransferase 1; NMN adenylyltransferase 1; NMN/NaMN adenylyltransferase 1; pyridine nucleotide adenylyltransferase 1
Gene Aliases: LCA9; NMNAT; NMNAT1; PNAT1
UniProt ID: (Human) Q9HAN9
Entrez Gene ID: (Human) 64802
Molecular Function:
nucleotidyltransferase
transferase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.