Novus Biologicals
Manufacturer Code:NBP258388
Catalog # NBP258388
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunocytochemistry (ICC) | Assay dependent |
Immunofluorescence (IF) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:FMFPEVIVEPIPIGQAAKDYLNLHIMPTLLEGLTELCKQKPADPLIWLADWLLKNNPNKPKLCHHPI |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: Inhibitor of p53-induced apoptosis-beta; Inhibitor of p53-induced apoptosis-beta IPIA-beta NDK-H 5 NDP kinase homolog 5 nm23-H5 NM23H5 non-metastatic cells 5 protein expressed in (nucleoside-diphosphate kinase) nucleoside diphosphate kinase homolog 5 radial spoke 23 homolog RSPH23 Testis-specific nm23 homolog; IPIA-beta; NDK-H 5; NDP kinase homolog 5; nm23-H5; non-metastatic cells 5 protein expressed in; non-metastatic cells 5, protein expressed in (nucleoside-diphosphate kinase); Nucleoside diphosphate kinase homolog 5; radial spoke 23 homolog; Testis-specific nm23 homolog
Gene Aliases: NM23-H5; NM23H5; NME5; RSPH23
UniProt ID: (Human) P56597
Entrez Gene ID: (Human) 8382
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.