Novus Biologicals
Manufacturer Code:NBP180992
Catalog # NBP180992
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunocytochemistry (ICC) | Assay dependent |
Immunofluorescence (IF) | Assay dependent |
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:MVLLSTLGIVFQGEGPPISSCDTGTMANCERTFIAIKPDGVQRGLVGEIIKRFEQKGFRLVGLKFMQ |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: C-myc purine-binding transcription factor PUF; C-myc purine-binding transcription factor PUF EC 2.7.13.3 EC 2.7.4.6 FLJ93990 Histidine protein kinase NDKB NDK B NDP kinase B NM23B nm23-H2 NM23-LV NME1-NME2 protein NME1-NME2 readthrough NME1-NME2 readthrough transcript NMELV; Histidine protein kinase NDKB; NDK B; nm23-H2; NME1-NME2 readthrough transcript; Nucleoside diphosphate kinase B
Gene Aliases: NM23-LV; NM23B; NME2; NMELV
UniProt ID: (Human) P22392
Entrez Gene ID: (Human) 654364
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.