Novus Biologicals
Manufacturer Code:NBP213659
Catalog # NBP213659
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: DEEDEGEKLSYLNSLAAADGHGDSGLCPQGYVHTVLRDSCSEPKEHEEEP EVVRDRSQKSCQLKKSLETAGDCKAAEESERPKPR |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: CSX3NK2.3 Homeobox protein NK-2 homolog C homeobox protein Nkx-2.3 NK2 transcription factor related locus 3 (Drosophila) NKX2.3 NKX23 NKX2CNK-2 (Drosophila) homolog C NKX4-3; Homeobox protein NK-2 homolog C; Homeobox protein Nkx-2.3; NK2 transcription factor related, locus 3
Gene Aliases: CSX3; NK2.3; NKX2-3; NKX2.3; NKX23; NKX2C; NKX4-3
UniProt ID: (Human) Q8TAU0
Entrez Gene ID: (Human) 159296
Molecular Function: DNA binding protein helix-turn-helix transcription factor homeobox transcription factor nucleic acid binding transcription factor
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.