Novus Biologicals
Manufacturer Code:NBP15892620UL
Catalog # NBP15892620
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to NKIRAS2(NFKB inhibitor interacting Ras-like 2) The peptide sequence was selected from the C terminal of NKIRAS2. Peptide sequence VKLWEVSVADRRSLLEPFVYLASKMTQPQSKSAFPLSRKNKGSGSLDG. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: DKFZP434N1526 I-kappa-B-interacting Ras-like protein 2 Kappa B-Ras protein 2 KappaB-Ras2 KBRAS2DKFZp434N1526 MGC74742 NF-kappa-B inhibitor-interacting Ras-like protein 2 NFKB inhibitor interacting Ras-like 2 NFKB inhibitor interacting Ras-like protein 2; I-kappa-B-interacting Ras-like protein 2; Kappa B-Ras protein 2; NF-kappa-B inhibitor-interacting Ras-like protein 2; NFKB inhibitor interacting Ras-like 2; NFKB inhibitor interacting Ras-like protein 2
Gene Aliases: kappaB-Ras2; KBRAS2; NKIRAS2
UniProt ID: (Human) Q9NYR9
Entrez Gene ID: (Human) 28511
Molecular Function:
G-protein
enzyme modulator
small GTPase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.