Novus Biologicals
Manufacturer Code:NBP157622
Catalog # NBP157622
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to SLC12A1(solute carrier family 12 (sodium/potassium/chloride transporters) member 1) The peptide sequence was selected from the N terminal of SLC12A1. Peptide sequence NEKKSRGFFNYQASIFAENFGPRFTKGEGFFSVFA |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: BSC1 Bumetanide-sensitive sodium-(potassium)-chloride cotransporter 2 Kidney-specific Na-K-Cl symporter MGC48843 NKCC2A variant A NKCC2Na-K-2Cl cotransporter solute carrier family 12 (sodium/potassium/chloride transporters) member 1 solute carrier family 12 member 1; Bumetanide-sensitive sodium-(potassium)-chloride cotransporter 2; Kidney-specific Na-K-Cl symporter; Na-K-2Cl cotransporter; NKCC2A variant A; solute carrier family 12 (sodium/potassium/chloride transporter), member 1; solute carrier family 12 (sodium/potassium/chloride transporters), member 1; Solute carrier family 12 member 1
Gene Aliases: BSC1; NKCC2; SLC12A1
UniProt ID: (Human) Q13621
Entrez Gene ID: (Human) 6557
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.