Novus Biologicals
Manufacturer Code:NBP256180
Catalog # NBP256180
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunocytochemistry (ICC) | Assay dependent |
Immunofluorescence (IF) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:QCLVMTGAPNSRPALLHLVHDFTKNVGLMICGHVHMGPRRQAMKEMSIDQAKYQRWLI |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: Basolateral Na-K-Cl symporter; Basolateral Na-K-Cl symporter BSC BSC2 Bumetanide-sensitive sodium-(potassium)-chloride cotransporter 1 NKCC1MGC104233 solute carrier family 12 (sodium/potassium/chloride transporters) member 2 solute carrier family 12 member 2; bumetanide-sensitive sodium-(potassium)-chloride cotransporter 1; Bumetanide-sensitive sodium-(potassium)-chloride cotransporter 2; protein phosphatase 1, regulatory subunit 141; solute carrier family 12 (sodium/potassium/chloride transporter), member 2; solute carrier family 12 (sodium/potassium/chloride transporters), member 2; Solute carrier family 12 member 2
Gene Aliases: BSC; BSC2; NKCC1; PPP1R141; SLC12A2
UniProt ID: (Human) P55011
Entrez Gene ID: (Human) 6558
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.