Novus Biologicals
Manufacturer Code:NBP190111
Catalog # NBP190111
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunocytochemistry (ICC) | Assay dependent |
Immunofluorescence (IF) | Assay dependent |
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:TFLGHIRLEPHKPQQIPIDSTVSFGASTRAYTLREKPQTLPSAVKGDEKMGGEDDELKGLLGLPEEETELDNLTEFNTAHNK |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: Activator of RNA decay; activator of RNA decay ard-1 ARD1nuclear inhibitor of protein phosphatase 1 NIPP1nuclear inhibitor of protein phosphatase-1 NIPP-1nuclear subunit of PP-1 PRO2047 Protein phosphatase 1 regulatory inhibitor subunit 8 protein phosphatase 1 regulatory subunit 8 protein phosphatase 1 regulatory (inhibitor) subunit 8 RNase E; ARD-1; NIPP-1; Nuclear inhibitor of protein phosphatase 1; nuclear inhibitor of protein phosphatase-1 alpha; nuclear inhibitor of protein phosphatase-1 beta; nuclear subunit of PP-1; Protein phosphatase 1 regulatory inhibitor subunit 8; protein phosphatase 1, regulatory (inhibitor) subunit 8; protein phosphatase 1, regulatory subunit 8; RNase E
Gene Aliases: ARD-1; ARD1; NIPP-1; NIPP1; PPP1R8; PRO2047
UniProt ID: (Human) Q12972
Entrez Gene ID: (Human) 5511
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.