Novus Biologicals
Manufacturer Code:NBP185110
Catalog # NBP185110
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunocytochemistry (ICC) | Assay dependent |
Immunofluorescence (IF) | Assay dependent |
Immunohistochemistry (IHC) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:TEEEERLWRDLIMERVTKSADACLTTINIMTSPNMPKAVYIEDVIERVIQYTKFHLQNTLYPQYDPVYRLDPHGGGLLSSKAKRAKCS |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: CDLS1 delangin DKFZp434L1319 FLJ11203 FLJ12597 FLJ13354 FLJ13648 FLJ44854 IDN3-B IDN3CDLS Nipped-B homolog (Drosophila) nipped-B-like protein Scc2 SCC2 homolog sister chromatid cohesion 2 homolog; Delangin; Nipped-B homolog; Nipped-B-like protein; SCC2 homolog; sister chromatid cohesion 2 homolog
Gene Aliases: CDLS; CDLS1; IDN3; IDN3-B; NIPBL; SCC2
UniProt ID: (Human) Q6KC79
Entrez Gene ID: (Human) 25836
Molecular Function:
DNA binding protein
chromatin/chromatin-binding protein
nucleic acid binding
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.