Novus Biologicals
Manufacturer Code:NBP213656
Catalog # NBP213656
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: LAGDTLPIEVYCHLPVMCEDRNLPYVYIPSKTDLGAAAGSKRPTCVIMVK PHEEYQEAYDECLEEVQSLP |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: FLJ20479 H/ACA ribonucleoprotein complex subunit 2 NHP2 ribonucleoprotein homolog (yeast) NHP2-like protein NHP2P NOLA2member 2 (H/ACA small nucleolar RNPs) Nucleolar protein family A member 2 snoRNP protein NHP2; H/ACA ribonucleoprotein complex subunit 2; NHP2 ribonucleoprotein homolog; NHP2-like protein; Nucleolar protein family A member 2; nucleolar protein family A, member 2 (H/ACA small nucleolar RNPs); snoRNP protein NHP2
Gene Aliases: DKCB2; HSPC286; NHP2; NHP2P; NOLA2
UniProt ID: (Human) A6NKY8
Entrez Gene ID: (Human) 55651
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.