Novus Biologicals
Manufacturer Code:NBP238683
Catalog # NBP238683
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunocytochemistry (ICC) | Assay dependent |
Immunofluorescence (IF) | Assay dependent |
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: SPESVDLVNEELKGKVLGLSRDPAKVAEEDEDDDGGIMMRSKETSSPGTDDVFTPAPSDSPSSQRIQRCLSDPGPHPEPGEGEPFFPKG |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: APNH; APNH1 APNHFLJ42224 Na(+)/H(+) antiporter amiloride-sensitive Na(+)/H(+) exchanger 1 Na+/H+ amiloride sensitive) Na-Li countertransporter NHE-1 NHE1Na+/H+ antiporter amiloride-sensitive sodium/hydrogen exchanger 1 solute carrier family 9 (sodium/hydrogen exchanger) isoform 1 (antiporter solute carrier family 9 (sodium/hydrogen exchanger) member 1 solute carrier family 9 (sodium/hydrogen exchanger) member 1 (antiporter Solute carrier family 9 member 1; Na(+)/H(+) antiporter, amiloride-sensitive; Na(+)/H(+) exchanger 1; Na-Li countertransporter; NHE-1; protein phosphatase 1, regulatory subunit 143; Sodium/hydrogen exchanger 1; solute carrier family 9 (sodium/hydrogen exchanger), isoform 1 (antiporter, Na+/H+, amiloride sensitive); solute carrier family 9 (sodium/hydrogen exchanger), member 1 (antiporter, Na+/H+, amiloride sensitive); Solute carrier family 9 member 1; solute carrier family 9, subfamily A (NHE1, cation proton antiporter 1), member 1
Gene Aliases: APNH; APNH1; LIKNS; NHE-1; NHE1; PPP1R143; SLC9A1
UniProt ID: (Human) P19634
Entrez Gene ID: (Human) 6548
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.