Novus Biologicals
Manufacturer Code:NBP154685
Catalog # NBP154685
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to NFS1 (NFS1 nitrogen fixation 1 homolog (S. cerevisiae)) The peptide sequence was selected from the middle region of NFS1. Peptide sequence TTQTEHKCVLDSCRSLEAEGFQVTYLPVQKSGIIDLKELEAAIQPDTSLV. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: cysteine desulfurase mitochondrial EC 2.8.1.7 NFS1 nitrogen fixation 1 homolog (S. cerevisiae) NifS NIFShomolog) nitrogen-fixing bacteria S-like protein; Cysteine desulfurase, mitochondrial; NFS1 nitrogen fixation 1 homolog; nitrogen fixation 1 (S. cerevisiae, homolog); nitrogen-fixing bacteria S-like protein
Gene Aliases: HUSSY-08; IscS; NFS1; NIFS
UniProt ID: (Human) Q9Y697
Entrez Gene ID: (Human) 9054
Molecular Function: lyase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.