Novus Biologicals
Manufacturer Code:NBP213654
Catalog # NBP213654
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: SLPDLVNLGHTWVFAITRHHNRVPREGRPEAEAAAPSRPPTLLVEPYLRI EQFRIPRDRLVGRSRPGLYSHLLDQL |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: C20orf163 chromosome 20 open reading frame 163 dJ337O18.6 FLJ30259 MGC125934 MGC125935 neuralized homolog 2 (Drosophila) neuralized-like 2 neuralized-like 2 (Drosophila) neuralized-like protein 2 OZZ Ozz-E3; neuralized homolog 2; Neuralized-like protein 2
Gene Aliases: C20orf163; NEURL2; OZZ; OZZ-E3
UniProt ID: (Human) Q9BR09
Entrez Gene ID: (Human) 140825
Molecular Function:
ligase
ubiquitin-protein ligase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.