Novus Biologicals
Manufacturer Code:NBP15670320UL
Catalog # NBP15670320
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to NEU4(sialidase 4) The peptide sequence was selected from the N terminal of NEU4. Peptide sequence TGTVFLFFIAVLGHTPEAVQIATGRNAARLCCVASRDAGLSWGSARDLTE. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: EC 3.2.1.18 FLJ35928 MGC102757 MGC18222 N-acetyl-alpha-neuraminidase 4 neuraminidase 4 sialidase 4 sialidase-4; N-acetyl-alpha-neuraminidase 4; neuraminidase 4 (sialidase); sialidase 4; Sialidase-4
Gene Aliases: LP5125; NEU4
UniProt ID: (Human) Q8WWR8
Entrez Gene ID: (Human) 129807
Molecular Function:
hydrolase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.