Novus Biologicals
Manufacturer Code:NBP169387
Catalog # NBP169387
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to NEU1(sialidase 1 (lysosomal sialidase)) The peptide sequence was selected from the middle region of NEU1. Peptide sequence VWSKDDGVSWSTPRNLSLDIGTEVFAPGPGSGIQKQREPRKGRLIVCGHG. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: Acetylneuraminyl hydrolase; Acetylneuraminyl hydrolase EC 3.2.1.18 exo-alpha-sialidase FLJ93471 G9 sialidase Lysosomal sialidase N-acetyl-alpha-neuraminidase 1 NANH NEU SIAL1 sialidase 1 (lysosomal sialidase) sialidase-1; exo-alpha-sialidase; G9 sialidase; Lysosomal sialidase; N-acetyl-alpha-neuraminidase 1; sialidase 1 (lysosomal sialidase); Sialidase-1
Gene Aliases: NANH; NEU; NEU1; SIAL1
UniProt ID: (Human) Q99519
Entrez Gene ID: (Human) 4758
Molecular Function:
hydrolase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.