Novus Biologicals
Manufacturer Code:NBP159273
Catalog # NBP159273
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to NELL2(NEL-like 2 (chicken)) The peptide sequence was selected from the N terminal of NELL2. Peptide sequence MESRVLLRTFCLIFGLGAVWGLGVDPSLQIDVLTELELGESTTGVRQVPG. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: nel (chicken)-like 2 NEL-like 2 (chicken) NEL-like protein 2 Nel-related protein 2 NRP2neural epidermal growth factor-like 2 protein kinase C-binding protein NELL2; NEL-like protein 2; NEL-related protein 2; neural epidermal growth factor-like 2; Protein kinase C-binding protein NELL2
Gene Aliases: NELL2; NRP2
UniProt ID: (Human) Q99435
Entrez Gene ID: (Human) 4753
Molecular Function: annexin calcium-binding protein calmodulin intracellular calcium-sensing protein
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.