Novus Biologicals
Manufacturer Code:NBP255487
Catalog # NBP255487
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunocytochemistry (ICC) | Assay dependent |
Immunofluorescence (IF) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:VYGEDMTPTLLRGAFSPFGNIIDLSMDPPRNCAFVTYEKMESADQAVAELNGTQVESVQLKVNIARKQPMLDAATGKSVWGSLAVQNSPKGCHRDKRTQIVYSDDVYKE |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: D6S45 negative elongation factor E negative elongation factor polypeptide E NELFE NELF-ERDmajor histocompatibility complex gene RD nuclear protein RD RNA binding protein RD RNA-binding protein RDP RNA-binding protein RD; major histocompatibility complex gene RD; Negative elongation factor E; negative elongation factor polypeptide E; NELF-E; nuclear protein; RD RNA binding protein; RD RNA-binding protein; RNA-binding protein RD
Gene Aliases: D6S45; NELF-E; NELFE; RD; RDBP; RDP
UniProt ID: (Human) P18615
Entrez Gene ID: (Human) 7936
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.