Novus Biologicals
Manufacturer Code:NBP154835
Catalog # NBP154835
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to NELF(nasal embryonic LHRH factor) The peptide sequence was selected from the middle region of NELF. Peptide sequence RERSFSRSWSDPTPMKADTSHDSRDSSDLQSSHCTLDEAFEDLDWDTEKG. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: Nasal embryonic LHRH factor; nasal embryonic LHRH factorMGC125369 nasal embryonic luteinizing hormone-releasing hormone factor; Nasal embryonic luteinizing hormone-releasing hormone factor; NMDA receptor synaptonuclear signaling and neuronal migration factor
Gene Aliases: HH9; NELF; NSMF
UniProt ID: (Human) Q6X4W1
Entrez Gene ID: (Human) 26012
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.