Novus Biologicals
Manufacturer Code:NBP185903
Catalog # NBP185903
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunofluorescence (IF) | Assay dependent |
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:ETLTFEDGMKFKEYECVKEHGDYTDKAFEKLHCPEAGFSTQTVAAVGNRRQWDGGAPQTLLQMMAVADITSTCPTGPDSESVLSVSRQEG |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: Never in mitosis A-related kinase 5; never in mitosis A-related kinase 5 NIMA (never in mitosis gene a)-related kinase 5 nimA-related protein kinase 5 serine/threonine-protein kinase Nek5; NIMA (never in mitosis gene a)-related kinase 5; NIMA-related kinase 5; NimA-related protein kinase 5; Serine/threonine-protein kinase Nek5
Gene Aliases: NEK5
UniProt ID: (Human) Q6P3R8
Entrez Gene ID: (Human) 341676
Molecular Function: kinase protein kinase transferase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.