Novus Biologicals
Manufacturer Code:NBP154974
Catalog # NBP154974
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to NEDD4L(neural precursor cell expressed developmentally down-regulated 4-like) The peptide sequence was selected from the middle region of NEDD4L. Peptide sequence TVTLSAPLEGAKDSPVRRAVKDTLSNPQSPQPSPYNSPK |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: E3 ubiquitin-protein ligase NEDD4-like; E3 ubiquitin-protein ligase NEDD4-like EC 6.3.2 EC 6.3.2.- FLJ33870 hNedd4-2 KIAA0439ubiquitin-protein ligase NEDD4-like NEDD4.2 Nedd4-2 NEDL3 neural precursor cell expressed developmentally down-regulated 4-like neural precursor cell expressed developmentally down-regulated gene 4-like RSP5ubiquitin-protein ligase Rsp5; HECT-type E3 ubiquitin transferase NED4L; Nedd4-2; NEDD4.2; ubiquitin-protein ligase Rsp5
Gene Aliases: hNEDD4-2; KIAA0439; NEDD4-2; NEDD4.2; NEDD4L; NEDL3; RSP5
UniProt ID: (Human) Q96PU5
Entrez Gene ID: (Human) 23327
Molecular Function:
ligase
ubiquitin-protein ligase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.