Novus Biologicals
Manufacturer Code:NBP179583
Catalog # NBP179583
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptide directed towards the N terminal of human Necap1The immunogen for this antibody is Necap1. Peptide sequence RYFVIRIQDGTGRSAFIGIGFTDRGDAFDFNVSLQDHFKWVKQETEISKE. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: Adaptin ear-binding coat-associated protein 1; adaptin ear-binding coat-associated protein 1 adaptin-ear-binding coat-associated protein 1 DKFZP566B183 MGC131900 NECAP endocytosis associated 1 NECAP endocytosis-associated protein 1 NECAP-1; NECAP endocytosis-associated protein 1; NECAP-1
Gene Aliases: EIEE21; NECAP1
UniProt ID: (Human) Q8NC96
Entrez Gene ID: (Human) 25977
Molecular Function:
ATP-binding cassette (ABC) transporter
transporter
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.