Novus Biologicals
Manufacturer Code:NBP156552
Catalog # NBP156552
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to NECAB3 (N-terminal EF-hand calcium binding protein 3) The peptide sequence was selected from the middle region of NECAB3)(50ug). Peptide sequence ESVEAQSRLCGSRRAGRRALRSVSRSSTWSPGSSDTGRSSEAEMQWRLQV. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: amyloid beta (A4) precursor protein-binding, family A, member 2 binding protein; amyloid beta A4 protein-binding family A member 2-binding protein; Amyloid beta A4 protein-binding family A member 2-binding protein APBA2BPfamily A member 2 binding protein dJ63M2.4 dJ63M2.5 EFCBP3STIP3 EF-hand calcium binding protein 3 Neuronal calcium-binding protein 3 neuronal calcium-binding protein NECAB3 NIP1Nek2-interacting protein 1 N-terminal EF-hand calcium binding protein 3 N-terminal EF-hand calcium-binding protein 3 synaptotagmin interacting protein 2 synaptotagmin interacting protein STIP3 SYTIP2 XB51X11L-binding protein 51; Amyloid-beta A4 protein-binding family A member 2-binding protein; EF-hand calcium binding protein 3; N-terminal EF-hand calcium-binding protein 3; Nek2-interacting protein 1; Neuronal calcium-binding protein 3; neuronal calcium-binding protein NECAB3; synaptotagmin interacting protein 2; synaptotagmin interacting protein STIP3; X11L-binding protein 51
Gene Aliases: APBA2BP; dJ63M2.4; dJ63M2.5; EFCBP3; NECAB3; NIP1; STIP3; SYTIP2; XB51
UniProt ID: (Human) Q96P71
Entrez Gene ID: (Human) 63941
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.