Novus Biologicals
Manufacturer Code:NBP19857620UL
Catalog # NBP19857620
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Mouse |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | The immunogen for this antibody is Ndufs6 - N-terminal region. Peptide sequence AARGFGVQVSPSGEKITHTGQVYDEKDYRRVRFVDRQKEVNENFAIDLIA. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: CI-13kD-A; CI13KDA Complex I-13kD-A mitochondrial respiratory chain 13-kD subunit NADH dehydrogenase (ubiquinone) Fe-S protein 6 (13kD) (NADH-coenzyme Qreductase) NADH dehydrogenase (ubiquinone) Fe-S protein 6 13kDa (NADH-coenzyme Qreductase) NADH dehydrogenase [ubiquinone] iron-sulfur protein 6 mitochondrial NADH:ubiquinone oxidoreductase NDUFS6 subunit NADH-ubiquinone oxidoreductase 13 kDa-A subunit; complex I 13kDa subunit A; complex I, mitochondrial respiratory chain, 13-kD subunit; Complex I-13kD-A; NADH dehydrogenase (ubiquinone) Fe-S protein 6, 13kDa (NADH-coenzyme Q reductase); NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial; NADH-ubiquinone oxidoreductase 13 kDa-A subunit; NADH:ubiquinone oxidoreductase NDUFS6 subunit
Gene Aliases: CI-13kA; CI-13kD-A; CI13KDA; NDUFS6
UniProt ID: (Human) O75380
Entrez Gene ID: (Human) 4726
Molecular Function:
oxidoreductase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.