Novus Biologicals
Manufacturer Code:NBP188933
Catalog # NBP188933
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:AMVKAEPDVKKLEDQLQGGQLEEVILQAEHELNLARKMREWKLWEPLVEEPPADQWKWPI |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: B135 (13kD B13) DKFZp781K1356 NADH dehydrogenase (ubiquinone) 1 alpha subcomplex 5 13kDa UQOR13FLJ12147; CI-13kD-B; complex I 13kDa subunit B; Complex I subunit B13; Complex I-13kD-B; NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 5; NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 5, 13kDa; NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 5; NADH-ubiquinone oxidoreductase 13 kDa-B subunit; type I dehydrogenase; ubiquinone reductase
Gene Aliases: B13; CI-13kB; CI-13KD-B; NDUFA5; NUFM; UQOR13
UniProt ID: (Human) Q16718
Entrez Gene ID: (Human) 4698
Molecular Function:
oxidoreductase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.