Novus Biologicals
Manufacturer Code:NBP181436
Catalog # NBP181436
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunocytochemistry (ICC) | Assay dependent |
Immunofluorescence (IF) | Assay dependent |
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:AAAGATGSEELPPGDRGCRNGGGRGPAATTSSTGVAVGAEHGEDSLSRKPDPEPGRMDHHQPGTGRYQVLLNEEDN |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: FLJ25842 KIAA1165N4WBP5APutative MAPK-activating protein PM04/PM05/PM06/PM07 MAPK-activating protein PM04 PM05 PM06 PM07 N4wbp5a Nedd4 family interacting protein 2 NEDD4 family-interacting protein 2 NEDD4 WW domain-binding protein 5A NF-kappa-B-activating protein 413 Putative NF-kappa-B-activating protein 413; MAPK-activating protein PM04 PM05 PM06 PM07; NEDD4 family-interacting protein 2; NEDD4 WW domain-binding protein 5A; NF-kappa-B-activating protein 413; Putative MAPK-activating protein PM04/PM05/PM06/PM07; Putative NF-kappa-B-activating protein 413
Gene Aliases: KIAA1165; N4WBP5A; NDFIP2
UniProt ID: (Human) Q9NV92
Entrez Gene ID: (Human) 54602
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.