Novus Biologicals
Manufacturer Code:NBP181234
Catalog # NBP181234
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:SRYQQLQNEEESGEPEQAAGDAPPPYSSISAESAAYFDYKDESGFPKP |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: Breast cancer-associated protein SGA-1M; Breast cancer-associated protein SGA-1M MGC10924 N4WBP5Putative NF-kappa-B-activating protein 164 Nedd4 family interacting protein 1 NEDD4 family-interacting protein 1 NEDD4 WW domain-binding protein 5 Putative MAPK-activating protein PM13 Putative NFKB and MAPK-activating protein; NEDD4 family-interacting protein 1; NEDD4 WW domain-binding protein 5; Putative MAPK-activating protein PM13; Putative NF-kappa-B-activating protein 164; Putative NFKB and MAPK-activating protein
Gene Aliases: N4WBP5; NDFIP1; PSEC0192; PSEC0223
UniProt ID: (Human) Q9BT67
Entrez Gene ID: (Human) 80762
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.