Novus Biologicals
Manufacturer Code:NBP232720
Catalog # NBP232720
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: MAVAQQLRAESDFEQLPDDVAISANIADIEEKRGFTSHFVFVIEVKTKGGSKYLIYRRY |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: MGC3810 NCF NCF-4 neutrophil cytosol factor 4 neutrophil cytosolic factor 4 (40kD) neutrophil cytosolic factor 4 40kDa Neutrophil NADPH oxidase factor 4 p40phox p40-phox SH3 and PX domain-containing protein 4 SH3PXD4P40PHOX; NCF-4; Neutrophil cytosol factor 4; neutrophil cytosolic factor 4, 40kDa; Neutrophil NADPH oxidase factor 4; p40-phox; p40phox; SH3 and PX domain-containing protein 4
Gene Aliases: CGD3; NCF; NCF4; P40PHOX; SH3PXD4
UniProt ID: (Human) Q15080
Entrez Gene ID: (Human) 4689
Molecular Function:
G-protein modulator
enzyme modulator
guanyl-nucleotide exchange factor
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.